PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G02460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 360aa    MW: 39866.1 Da    PI: 9.6828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G02460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.99.6e-083175346
                     SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqk 46
                     +W++eE +++ +a + l  +  +W+++ar ++ gR+  ++  ++ +
  LPERR01G02460.1 31 KWSPEENKQFERALAGLDLRcpDWERVARAIP-GRSVFEVMTHFKD 75
                     8*****************99************.********99986 PP

2Myb_DNA-binding47.73.5e-15146190347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  LPERR01G02460.1 146 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 190
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.9092781IPR017884SANT domain
SMARTSM007170.00492879IPR001005SANT/Myb domain
SuperFamilySSF466894.64E-83184IPR009057Homeodomain-like
PfamPF002496.5E-63176IPR001005SANT/Myb domain
CDDcd001677.34E-63176No hitNo description
PROSITE profilePS5129418.359139195IPR017930Myb domain
SuperFamilySSF466898.97E-18140195IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-17142193IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.1E-12143189IPR009057Homeodomain-like
SMARTSM007173.4E-13143193IPR001005SANT/Myb domain
PfamPF002491.3E-12146190IPR001005SANT/Myb domain
CDDcd001671.71E-11146191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MMMRDACMEV LPPPIAMDHY ASRGNWLMAR KWSPEENKQF ERALAGLDLR CPDWERVARA  60
IPGRSVFEVM THFKDLEVDV QQIENGLVPF PVYAGGGGGG AFTLQWDHGG VGDLRNAYRF  120
GGGGGGGKRH FGGGRTPEQE RKKGVPWTEE EHKLFLLGLK KYGKGDWRNI SRNFVQTRTP  180
TQVASHAQKY FIRLNSGGKD KRRSSIHDIT TVNLTDDRPP SPSQSSMISN QSNTSTLTAA  240
VAPFSSTADV KPQNAVNSSF NSPSRTLGMP AYGLGLQDQV GFQPKHIVLD ATNPSSTRIR  300
RLVLYCLACS FTTCIEVINY GNFSEHSRGW MDLSVILVTD ALWSIIVGNT ENVTKRTSRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-142198378RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133GGKRHFGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679640.0AK067964.1 Oryza sativa Japonica Group cDNA clone:J013124L02, full insert sequence.
GenBankEU8372500.0EU837250.1 Oryza sativa Japonica Group clone KCB707G04 myb transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621817.11e-174PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-76DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D9UWL90.0A0A0D9UWL9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA002421-PA1e-174(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-58MYB family protein